Protein coding transcript 126005

• Transcript: Ll_transcript_481189
• CDS coordinates: 1875-2363 (+)
• Peptide sequence: MCMEITIFQTIKTNVIGTLNMLGLAKRVGARILLTSTSEVYGDPLVHPQPESYWGNVNPIGVRSCYDEGKRVAETLMFDYHRQHGLEIRIARIFNTYGPRMNIDDGRVVSNFIAQALRGESLTVQSPGTQTRSFCYVSDLVDGLIRLMGGSDTGPINLGNPG*
• ORF Type: complete

Annotations of Ll_transcript_481189

• Blastp: UDP-glucuronic acid decarboxylase 3 from Arabidopsis with 94.16% of identity
• Blastx: UDP-glucuronic acid decarboxylase 3 from Arabidopsis with 94.16% of identity
• Eggnog: Nad-dependent epimerase dehydratase(COG0451)
• Kegg: Link to kegg annotations (AT5G59290)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019448643.1)
• Pfam: NAD dependent epimerase/dehydratase family (PF01370.20)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;