Protein coding transcript 126009

• Transcript: Ll_transcript_481201
• CDS coordinates: 126-500 (+)
• Peptide sequence: MAANSSNGDHVASKQPPLPSPLRNSKFFQSNMRILVTGGAGFIGSHLVDRLMENEKNEVIVADNYFTGSKDNLKKWIGHPRFELIRHDVTEPLLVEVDQIYHLACPASPIFYKYNPVKTIKTNVI
• ORF Type: 3prime_partial

Annotations of Ll_transcript_481201

• Blastp: UDP-glucuronic acid decarboxylase 6 from Arabidopsis with 87.2% of identity
• Blastx: UDP-glucuronic acid decarboxylase 6 from Arabidopsis with 87.2% of identity
• Eggnog: Nad-dependent epimerase dehydratase(COG0451)
• Kegg: Link to kegg annotations (AT2G28760)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019413045.1)
• Pfam: NAD dependent epimerase/dehydratase family (PF01370.20)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;