Transcript | Ll_transcript_479586 |
---|---|
CDS coordinates | 294-1091 (+) |
Peptide sequence | MSKIILSSPSPTLFPLTLFFILLLLLHPCEAEDVAIYWGQNVKEGNLTETCATAKYSFINIAFLTTFGSSKTPQLNLAGHCDPSTNGCTLIGRDIMNCQNQGIKVMLSIGGGSEGSYALTSSEDAKNVSDYLWNNFLGGTNYTSSRPFGDAILDGIDFDIYGTNSHWDELARYLKSHNNNTTTKTIYLTAAPQCTFPDYSMGTALDTGLFDYVWIQFYNNPPCDYGKESIDNIVNAWNKWTTSLKGAKVFLGLPADPAAAATAKH* |
ORF Type | complete |
Blastp | Acidic endochitinase from Vitis with 58.66% of identity |
---|---|
Blastx | Cysteine-rich receptor-like protein kinase 10 from Arabidopsis with 53.35% of identity |
Eggnog | - |
Kegg | Link to kegg annotations (100233088) |
CantataDB | Link to cantataDB annotations (CNT0001079) |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019458282.1) |
Pfam | Glycosyl hydrolases family 18 (PF00704.27) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer