Protein coding transcript 126094

• Transcript: Ll_transcript_480475
• CDS coordinates: 314-1204 (+)
• Peptide sequence: MAAKQGDQETPPLGETLKYKTWVLRVLIHCDGCKKKVKKVLHGIDGVYTIDVDSQQHKVTVTGNVEAETLIKKLERTGKFAELLPEINPPEKKDNKKSKSSDNNKNNEPVEDGSNNSNEGCIEEESDKEDHNDECKDSPGGGAGGGGGSSEGGKKKKKKKKKNKGNGNSDSAPPNNEVVVIGGGKEETSKVDAGPVPSNLVTSVSSREIIGPPIQHAYPSYPQQMYYSLPLPNPPYGLSYNTTYPASSASYYVDAPIMPMHAYNIPYPHLPPPPPPSNITNHYGDDNEYEGGCSIM*
• ORF Type: complete

Annotations of Ll_transcript_480475

• Blastp: Heavy metal-associated isoprenylated plant protein 36 from Arabidopsis with 63.38% of identity
• Blastx: Heavy metal-associated isoprenylated plant protein 36 from Arabidopsis with 63.38% of identity
• Eggnog: heavy metal transport detoxification protein(COG2608)
• Kegg: Link to kegg annotations (AT5G27690)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019421652.1)
• Pfam: Heavy-metal-associated domain (PF00403.25)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;