Protein coding transcript 126179

• Transcript: Ll_transcript_480931
• CDS coordinates: 333-752 (+)
• Peptide sequence: MDGLISIETKVNDLISHLRLELQDTHLIGIWGMGGIGKTTLADVVYNRIKSKFDFSCFLPNVREAYNEGDQGLVKLQDKLLSQYKPKSMVIDTARQGKDMIKNFLHNKKVLLVLDDVNAEIQLEHLAGNQNWFGGGSRII
• ORF Type: 3prime_partial

Annotations of Ll_transcript_480931

• Blastp: TMV resistance protein N from Nicotiana with 37.41% of identity
• Blastx: TMV resistance protein N from Nicotiana with 35.47% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019452279.1)
• Pfam: NB-ARC domain (PF00931.21)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;