Protein coding transcript 126189

• Transcript: Ll_transcript_479402
• CDS coordinates: 110-898 (+)
• Peptide sequence: MATTCKFSKNDSKPFDNPTLFRSIVGALQYATITRPDLAFSVNKVCQFMSKPLEQHWVAVKRILRYLQGTMTFGIHLKAVVCPSMPIHLTALCDADWATDLDDRKSVSGACLFLGPNIIAWWSRKQQTMSRSSTEAEYRSLALASQELVWVESLLTELKVPYQTPLILCDNLSTVGMAHNPVLHNRTKHIELDLFFVRDKIQAKLLQVKHIPSEFQTADVLTKPLATSKFLVLRKQLRVADLASIVQLPSDSGGYIRDQILN*
• ORF Type: complete

Annotations of Ll_transcript_479402

• Blastp: Copia protein from Sophophora with 36.53% of identity
• Blastx: Uncharacterized mitochondrial protein AtMg00810 from Arabidopsis with 45.7% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019429729.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;