| Transcript | Ll_transcript_480549 |
|---|---|
| CDS coordinates | 3-335 (+) |
| Peptide sequence | QEAKQNQNEAISAAQERYERAKQAANETLSNTTQTTQEKASQAKDIALEKGQQGYGPTKDTITQAKHATTQKGQQGYATTKDIITGVAITTVEYTVQWLKRPTITQFKQL* |
| ORF Type | 5prime_partial |
| Blastp | Myosin-binding protein 3 from Arabidopsis with 36.19% of identity |
|---|---|
| Blastx | Seed biotin-containing protein SBP65 from Pisum with 52.83% of identity |
| Eggnog | Pfam:DUF593(ENOG410YA8U) |
| Kegg | Link to kegg annotations (AT5G16720) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019432817.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer