| Transcript | Ll_transcript_480534 |
|---|---|
| CDS coordinates | 1-372 (+) |
| Peptide sequence | IKKINVMICIAAILDPRNKFHLVKWGLERIHNKDDAIVLCEKIKDMLYKMFDKYRLFLSEGQENSSQTTHEIEMLDSNASNEVSVAMVFKKYMNLHETMNKNEVDLYLKEGLEKKIPNFDILN* |
| ORF Type | 5prime_partial |
| Blastp | - |
|---|---|
| Blastx | Zinc finger BED domain-containing protein RICESLEEPER 1 from Oryza sativa with 51.79% of identity |
| Eggnog | - |
| Kegg | - |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_020992218.1) |
| Pfam | Domain of unknown function (DUF4413) (PF14372.5) |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer