Protein coding transcript 12629

• Transcript: Ll_transcript_411835
• CDS coordinates: 110-673 (+)
• Peptide sequence: MGKGAGCIPSKNKPPTVTIDSPRATPSTSRDAPILPGVTLHTDQTPNAVQETAPLNSVDAKLKILIVFYSMYGHVEGLAKRLKKGVDGVEGVEGVLYRVPETLPIEVLAQMKAPPKDDTVPEITAADLAGADGLLFGFPTRYGSMAAQMKGFFDSTGQLWKEQKLAGKPAGFFVSTGTQGGGQETTA*
• ORF Type: complete

Annotations of Ll_transcript_411835

• Blastp: Probable NAD(P)H dehydrogenase (quinone) FQR1-like 2 from Arabidopsis with 61.69% of identity
• Blastx: Probable NAD(P)H dehydrogenase (quinone) FQR1-like 2 from Arabidopsis with 59.26% of identity
• Eggnog: Nadph-dependent fmn reductase(COG0655)
• Kegg: Link to kegg annotations (AT4G36750)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019423467.1)
• Pfam: NADPH-dependent FMN reductase (PF03358.14)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;