Transcript | Ll_transcript_411838 |
---|---|
CDS coordinates | 110-673 (+) |
Peptide sequence | MGKGAGCIPSKNKPPTVTIDSPRATPSTSRDAPILPGVTLHTDQTPNAVQETAPLNSVDAKLKILIVFYSMYGHVEGLAKRLKKGVDGVEGVEGVLYRVPETLPIEVLAQMKAPPKDDTVPEITAADLAGADGLLFGFPTRYGSMAAQMKGFFDSTGQLWKEQKLAGKPAGFFVSTGTQGGGQETTA* |
ORF Type | complete |
Blastp | Probable NAD(P)H dehydrogenase (quinone) FQR1-like 2 from Arabidopsis with 61.69% of identity |
---|---|
Blastx | Probable NAD(P)H dehydrogenase (quinone) FQR1-like 2 from Arabidopsis with 59.26% of identity |
Eggnog | Nadph-dependent fmn reductase(COG0655) |
Kegg | Link to kegg annotations (AT4G36750) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019423467.1) |
Pfam | NADPH-dependent FMN reductase (PF03358.14) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer