Protein coding transcript 126388

• Transcript: Ll_transcript_480214
• CDS coordinates: 212-661 (+)
• Peptide sequence: MTRNDTNPFEEEQEVNPFSEETAKEKRSGQSSYDGGAFYTTKNPGSVPSTTSSLSPLPHEPYDRGATIDIPLDSAKDVKAKEKELQAKEAELKKREQEVKRREDAIARAGIVVEEKNWPPFFPIIHHNIADEIPIHLQRVQYVAFTTWLG
• ORF Type: 3prime_partial

Annotations of Ll_transcript_480214

• Blastp: Secretory carrier-associated membrane protein 1 from Oryza sativa with 67.33% of identity
• Blastx: Putative secretory carrier-associated membrane protein 1 from Oryza sativa with 63.4% of identity
• Eggnog: secretory carrier membrane protein(ENOG410XSJN)
• Kegg: Link to kegg annotations (4343617)
• CantataDB: Link to cantataDB annotations (CNT0000241)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019412917.1)
• Pfam: SCAMP family (PF04144.12)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;