Protein coding transcript 126425

• Transcript: Ll_transcript_479021
• CDS coordinates: 32-394 (+)
• Peptide sequence: MYRHTFLLSSSKKQEIWQTVEKLLVDNQVEVREHAAAVLAGLMKGGDEKLAKDFRDRAYVEANVVQKRRKSRLFFLLMIWETYLFCRKAGLNLEILVHFFEFSVIFPFCMVLLSYNLGQS*
• ORF Type: complete

Annotations of Ll_transcript_479021

• Blastp: Proteasome activator subunit 4 from Arabidopsis with 78.05% of identity
• Blastx: Proteasome activator subunit 4 from Arabidopsis with 78.05% of identity
• Eggnog: Proteasome (Prosome, macropain) activator subunit 4(ENOG410XP7J)
• Kegg: Link to kegg annotations (AT3G13330)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019430869.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;