| Transcript | Ll_transcript_479026 |
|---|---|
| CDS coordinates | 1-327 (+) |
| Peptide sequence | HPFLSLSLSLSLSLSLTHLSCPESCSLSHTFLVLKVVSNLSLSLSLSLSIYTHTHDSFSIITTKTFIFLHSKNASLQCMASTACRRPNRRRERLLPPPSLNSQLLLPL* |
| ORF Type | 5prime_partial |
| Blastp | - |
|---|---|
| Blastx | Proteasome activator subunit 4 from Arabidopsis with 57.45% of identity |
| Eggnog | Proteasome (Prosome, macropain) activator subunit 4(ENOG410XP7J) |
| Kegg | Link to kegg annotations (AT3G13330) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019425529.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer