Protein coding transcript 126431

• Transcript: Ll_transcript_479028
• CDS coordinates: 32-535 (+)
• Peptide sequence: MYRHTFLLSSSKKQEIWQTVEKLLVDNQVEVREHAAAVLAGLMKGGDEKLAKDFRDRAYVEANVVQKRRKSRNSRSGSAVASIHGAVLALAASVLSAPYDMPSWLPEHVTLLARFSGEPSPVKSTVTKAVAEFRRTHADTWNVQKEFFTEEQLEILADTSSSSSYFA*
• ORF Type: complete

Annotations of Ll_transcript_479028

• Blastp: Transcription factor MYB80 from Oryza sativa with 37.31% of identity
• Blastx: Proteasome activator subunit 4 from Arabidopsis with 79.66% of identity
• Eggnog: Myblike DNAbinding domain containing protein(COG5147)
• Kegg: Link to kegg annotations (9272494)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019430871.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;