Protein coding transcript 126546

• Transcript: Ll_transcript_478953
• CDS coordinates: 135-536 (+)
• Peptide sequence: MLASLIFCFSNYVLRLYGCTQLDASNLYALFNGLRSLETLLLEECLNLHEIPDNISLLCSLHHLLLKGTNVERFPTSIKHLTNLEKLDLSDCKRLHFLPELPLSIKELYATNCSSLETVMFPLRTTDLVHAYKS
• ORF Type: 3prime_partial

Annotations of Ll_transcript_478953

• Blastp: TMV resistance protein N from Nicotiana with 47.5% of identity
• Blastx: Disease resistance protein RML1B from Arabidopsis with 49.12% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019436492.1)
• Pfam: Leucine Rich Repeat (PF00560.32)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;