Transcript | Ll_transcript_479526 |
---|---|
CDS coordinates | 41-550 (+) |
Peptide sequence | MTSNVGSSVIEKGGRRIGFDLDYDEKDSSYNKIKNLVTEELKQYFRPEFLNRLDEMIVFRQLTKLEVKEIADIMLNEVFERLKTKEIELQVTERFRDRVVEEGYNPSYGARPLRRAIMRLLEDSMAEKMLAREIKEGDSVIVDVDSDGNVIVLNGSSGTPESLPEPLPV* |
ORF Type | complete |
Blastp | Chaperone protein ClpC, chloroplastic from Pisum with 95.05% of identity |
---|---|
Blastx | Chaperone protein ClpC, chloroplastic from Pisum with 95.05% of identity |
Eggnog | - |
Kegg | - |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019437203.1) |
Pfam | AAA domain (Cdc48 subfamily) (PF07724.13) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer