Protein coding transcript 126644

• Transcript: Ll_transcript_481272
• CDS coordinates: 2-301 (+)
• Peptide sequence: KILSARDIGTGCLLFGSMLDDIGIDLPKAPNNFGEIIGKLILGGGLDFKVVTEILKKVEDDRFQKAIFDAAVQVITAASAQAVLDSQASDIEACRSVLN*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_481272

• Blastp: Eukaryotic translation initiation factor isoform 4G-1 from Arabidopsis with 62.24% of identity
• Blastx: Eukaryotic translation initiation factor isoform 4G-1 from Arabidopsis with 62.24% of identity
• Eggnog: Eukaryotic translation initiation factor 4 gamma(ENOG410XS4P)
• Kegg: Link to kegg annotations (AT5G57870)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019441684.1)
• Pfam: MA3 domain (PF02847.16)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;