Protein coding transcript 126645

• Transcript: Ll_transcript_481275
• CDS coordinates: 2140-2940 (+)
• Peptide sequence: MHTNKVARILGKVENNDRFLRIALYQGDRSSKKVRKIPAAAANANESKDPLTDPTLLCCAFKKHRIYLFSRREPEEPEDATKGRDVFNEKPPADELLAVSDIGKAATTSLPDNVILHTTMGDVHMKLYPEECPKTVENFTTHCRNGYYDNLIFHRVIKGFMIQTGDPLGDGTGGQSIWGREFEDEFHKSLRHDRPFTVSMANAGQNTNGSQFFITTVATPWLDNKHTVFGRVVKGMDVVQGIEKVKTDKTDKPYQDVKILNVTVPK*
• ORF Type: complete

Annotations of Ll_transcript_481275

• Blastp: Peptidyl-prolyl cis-trans isomerase CYP71 from Arabidopsis with 88.35% of identity
• Blastx: Peptidyl-prolyl cis-trans isomerase CYP71 from Arabidopsis with 87.73% of identity
• Eggnog: peptidylprolyl isomerase domain and WD(ENOG410XQB4)
• Kegg: Link to kegg annotations (AT3G44600)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019435303.1)
• Pfam: Cyclophilin type peptidyl-prolyl cis-trans isomerase/CLD (PF00160.20)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;