Protein coding transcript 126692

• Transcript: Ll_transcript_479713
• CDS coordinates: 2-1042 (+)
• Peptide sequence: TSSLEGSSVNVPDQLHQRKRASRNRHDEYIANDPGILTRRMSNLNEKKVSWLMLSEQEEGYRFIPQLGDEVVYMRQGHHEYIESFMLKESGPWKSCIGVSASEICRVEELEYAVLPGSGDSCCKLKLRFVDPSSHVNGKSFKLTLPELINFADFVVEKTWYDTAVNRNWSLRDKCLVWWRNEDGKSGSWWDGQITAVQPKSHDFPDSPWERYEIQYRTDLTETHLHSPWELYDPEIQWEHPRIDPGIKDTLLSYFTKIEHRGYDIQALDQLSEKSEFSNRFPVQFYPELIQKRLKNDYYRRVEAVKHDIMVMLSSAEEYYTVSKNVQFSTMVRRMSDWFRRKLDRL*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_479713

• Blastp: Bromodomain and WD repeat-containing protein 1 from Mus with 32.2% of identity
• Blastx: Bromodomain and WD repeat-containing protein 1 from Mus with 32.77% of identity
• Eggnog: wd repeat(COG2319)
• Kegg: Link to kegg annotations (93871)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019452357.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;