| Transcript | Ll_transcript_479513 |
|---|---|
| CDS coordinates | 122-568 (+) |
| Peptide sequence | MAPAIGIDLGTTYSCVGIYRDDRIEIIANDQGNRTTPSFVAFTDTERLIGDSAKNQVAMNPHNTVFDAKRLIGRKFADAEVQADMKHFPFKVIDKAGKPVVQVEFKGEEKTFTPEEISSMVLTKMRETAESYLGGTVNNAVVTVPAYFN |
| ORF Type | 3prime_partial |
| Blastp | Heat shock 70 kDa protein from Cladosporium with 94.63% of identity |
|---|---|
| Blastx | Heat shock 70 kDa protein from Cladosporium with 94.63% of identity |
| Eggnog | - |
| Kegg | - |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_020977915.1) |
| Pfam | Hsp70 protein (PF00012.19) |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer