| Transcript | Ll_transcript_481773 |
|---|---|
| CDS coordinates | 219-566 (+) |
| Peptide sequence | MDSQQSNLFDTVSQPDPGNDAYAFLEFNTQGEDFDYPEFCDPIRSPVSWPTPSDSLAEPLERGGGGGGAGSDHQSDASPVSAAPGSATKGRSGSGGGNSQMVDALLPGMSGLNFED |
| ORF Type | 3prime_partial |
| Blastp | Regulator of nonsense transcripts 1 homolog from Arabidopsis with 46.4% of identity |
|---|---|
| Blastx | Regulator of nonsense transcripts 1 homolog from Arabidopsis with 46.4% of identity |
| Eggnog | Helicase(COG1112) |
| Kegg | Link to kegg annotations (AT5G47010) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019421384.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer