Protein coding transcript 126884

• Transcript: Ll_transcript_480439
• CDS coordinates: 1-666 (+)
• Peptide sequence: VGVNVNGVSSIVSEPAAYFEERNPYVKEEFSMEKVDAVQAWIEYDGEKKIVNVTVAPLSSKKPNKPLISNNIDLNNVLKDNMFVGFSASTGQEASFHYILGWSFAMNGIAPSLNISQLPKPPSKLQDFSSSFPWVKVAISILSALTFTLLCLLLFQTLYKRYNNFEALEEWELDCPHRFGYKDLHIATKGFKESELLGVGGFGAVYKGVLPTTGIEVAVNKI
• ORF Type: internal

Annotations of Ll_transcript_480439

• Blastp: L-type lectin-domain containing receptor kinase V.9 from Arabidopsis with 44.3% of identity
• Blastx: L-type lectin-domain containing receptor kinase V.9 from Arabidopsis with 44.5% of identity
• Eggnog: Serine Threonine protein kinase(COG0515)
• Kegg: Link to kegg annotations (AT4G29050)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019429697.1)
• Pfam: Legume lectin domain (PF00139.18)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;