Transcript | Ll_transcript_479822 |
---|---|
CDS coordinates | 707-1285 (+) |
Peptide sequence | MKAGIVESHQVLTVSPYYAEELVSGPDKGVELDNILRKTGIIGIVNGMDVQEWNPSTDKYITVKYTATTVLEGKALLKEALQAEVGLPVDRNIPIICFIGRLEEQKGSDILVEAIRQFIKENVQIVALGTGKKQMEKQLHQLEVSYPDKARGVAKFNVPLAHMIIAGADFILIPSRFEPCGLIQLQAMRYGTV |
ORF Type | 3prime_partial |
Blastp | Granule-bound starch synthase 1, chloroplastic/amyloplastic from Manihot with 77.72% of identity |
---|---|
Blastx | Granule-bound starch synthase 1, chloroplastic/amyloplastic from Manihot with 78.05% of identity |
Eggnog | - |
Kegg | - |
CantataDB | Link to cantataDB annotations (CNT0001477) |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019454627.1) |
Pfam | Starch synthase catalytic domain (PF08323.10) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer