Protein coding transcript 127065

• Transcript: Ll_transcript_493343
• CDS coordinates: 300-632 (+)
• Peptide sequence: MPNKNLEKMASIDAQLRQLVPAKVSEDDKLVEYDALLLDRFLDILQDLHGEDLRETVQEVYELSAEYEEKHEPEKLEKLGNIITSLDAGDSIVFAKAFSHMLNLANLAEEV
• ORF Type: 3prime_partial

Annotations of Ll_transcript_493343

• Blastp: Phosphoenolpyruvate carboxylase, housekeeping isozyme from Soja with 90.09% of identity
• Blastx: Phosphoenolpyruvate carboxylase, housekeeping isozyme from Soja with 90.09% of identity
• Eggnog: phosphoenolpyruvate carboxylase activity(COG2352)
• Kegg: Link to kegg annotations (547769)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019453559.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;