Transcript | Ll_transcript_493345 |
---|---|
CDS coordinates | 215-547 (+) |
Peptide sequence | MPNKNLEKMASIDAQLRQLVPAKVSEDDKLVEYDALLLDRFLDILQDLHGEDLRETVQEVYELSAEYEEKHEPEKLEKLGNIITSLDAGDSIVFAKAFSHMLNLANLAEEV |
ORF Type | 3prime_partial |
Blastp | Phosphoenolpyruvate carboxylase, housekeeping isozyme from Soja with 90.09% of identity |
---|---|
Blastx | Phosphoenolpyruvate carboxylase, housekeeping isozyme from Soja with 90.09% of identity |
Eggnog | phosphoenolpyruvate carboxylase activity(COG2352) |
Kegg | Link to kegg annotations (547769) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019453559.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer