Protein coding transcript 127116

• Transcript: Ll_transcript_491910
• CDS coordinates: 3-653 (+)
• Peptide sequence: AAETGGASGGMVRQLSIDQFENEGRRVSYGTPENATAARKLLDRQMSINSVPKKIIAHLLKPRGWKPPVRRQFFLDCNEIADLCDTAERIFSSEPSVIRLRAPIKIFGDLHGQFGDLMRLFDEYGAPSTAGDIAYIDYLFLGDYVDRGQHSLETISLLLALKIEYPNNVHLIRGNHEAADINALFGFRIECIERMGERDGIWAWHRINRVFNWLPLA
• ORF Type: internal

Annotations of Ll_transcript_491910

• Blastp: Serine/threonine-protein phosphatase BSL3 from Arabidopsis with 92.17% of identity
• Blastx: Serine/threonine-protein phosphatase BSL3 from Arabidopsis with 92.17% of identity
• Eggnog: serine threonine-protein phosphatase(COG0639)
• Kegg: Link to kegg annotations (AT2G27210)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019453832.1)
• Pfam: Serine-threonine protein phosphatase N-terminal domain (PF16891.4)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;