Protein coding transcript 127119

• Transcript: Ll_transcript_491895
• CDS coordinates: 1-867 (+)
• Peptide sequence: QISISSVPKKIIAHLLKPRGWKPPVRRQFFLDCNEIADLCDTAERIFSGEPSVIQLRAPIKIFGDLHGQFGDLMRLFDEYGAPSTAGDIAYIDYLFLGDYVDRGQHSLETISLLLALKVEYPNNVHLIRGNHEAADINALFGFRIECIERMGERDGIWAWHRINRLFNWLPLAALIEKKIICMHGGIGRSINHVEQIENIQRPITMEAGSIVLMDLLWSDPTENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHLITLFSATNYCG
• ORF Type: internal

Annotations of Ll_transcript_491895

• Blastp: Serine/threonine-protein phosphatase BSL2 homolog from Oryza sativa with 95.16% of identity
• Blastx: Serine/threonine-protein phosphatase BSL2 homolog from Oryza sativa with 95.16% of identity
• Eggnog: serine threonine-protein phosphatase(COG0639)
• Kegg: Link to kegg annotations (4352808)
• CantataDB: -
• Mirbase: hvu-MIR6182 (MI0021496)
• Ncbi protein: Link to NCBI protein (XP_019448888.1)
• Pfam: Calcineurin-like phosphoesterase (PF00149.27)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;