Transcript | Ll_transcript_491895 |
---|---|
CDS coordinates | 1-867 (+) |
Peptide sequence | QISISSVPKKIIAHLLKPRGWKPPVRRQFFLDCNEIADLCDTAERIFSGEPSVIQLRAPIKIFGDLHGQFGDLMRLFDEYGAPSTAGDIAYIDYLFLGDYVDRGQHSLETISLLLALKVEYPNNVHLIRGNHEAADINALFGFRIECIERMGERDGIWAWHRINRLFNWLPLAALIEKKIICMHGGIGRSINHVEQIENIQRPITMEAGSIVLMDLLWSDPTENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHLITLFSATNYCG |
ORF Type | internal |
Blastp | Serine/threonine-protein phosphatase BSL2 homolog from Oryza sativa with 95.16% of identity |
---|---|
Blastx | Serine/threonine-protein phosphatase BSL2 homolog from Oryza sativa with 95.16% of identity |
Eggnog | serine threonine-protein phosphatase(COG0639) |
Kegg | Link to kegg annotations (4352808) |
CantataDB | - |
Mirbase | hvu-MIR6182 (MI0021496) |
Ncbi protein | Link to NCBI protein (XP_019448888.1) |
Pfam | Calcineurin-like phosphoesterase (PF00149.27) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer