Protein coding transcript 127121

• Transcript: Ll_transcript_491898
• CDS coordinates: 716-1162 (+)
• Peptide sequence: MHGGIGRSINHVEQIENIQRPITMEAGSIVLMDLLWSDPTENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHLITLFSATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPASSSPETSPERHIED
• ORF Type: 3prime_partial

Annotations of Ll_transcript_491898

• Blastp: Serine/threonine-protein phosphatase BSL3 from Arabidopsis with 98.66% of identity
• Blastx: Serine/threonine-protein phosphatase BSL3 from Arabidopsis with 91.71% of identity
• Eggnog: serine threonine-protein phosphatase(COG0639)
• Kegg: Link to kegg annotations (AT2G27210)
• CantataDB: -
• Mirbase: hvu-MIR6182 (MI0021496)
• Ncbi protein: Link to NCBI protein (XP_019413311.1)
• Pfam: Calcineurin-like phosphoesterase (PF00149.27)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;