Protein coding transcript 12717

• Transcript: Ll_transcript_412136
• CDS coordinates: 1912-2316 (+)
• Peptide sequence: MQSVLQVEKTECRNCLIWAKSDNLAREVIKISSDMKVGYIVMREPKTGARTNLLRMKGAEVVGVYHPLIDEKLMKILRRRNKKVYAWTVDDEESMQKMLFENVDAIVTGNPTLLQQLMQNTKTQCLEEGYSLPN*
• ORF Type: complete

Annotations of Ll_transcript_412136

• Blastp: Glycerophosphodiester phosphodiesterase GDPD4 from Arabidopsis with 59.09% of identity
• Blastx: Glycerophosphodiester phosphodiesterase GDPD4 from Arabidopsis with 59.09% of identity
• Eggnog: glycerophosphoryl diester phosphodiesterase(COG0584)
• Kegg: Link to kegg annotations (AT1G71340)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019434592.1)
• Pfam: Glycerophosphoryl diester phosphodiesterase family (PF03009.16)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;