Protein coding transcript 127176

• Transcript: Ll_transcript_493866
• CDS coordinates: 657-1124 (+)
• Peptide sequence: MFCFPVDHENVVTLRRGKPDECEKIVEDRAYKQQVQHDGAQKMGHKTDGPTFERYAAVPTVDDTVGGGATPILPVQRVSRTEGCETDPRMWSLNVGGGRPYNSSKGDICMDECRLVLYQYSAKGSWVNHLVGCDPVKQRKYVYSPLFTTSVCPSD*
• ORF Type: complete

Annotations of Ll_transcript_493866

• Blastp: Retrovirus-related Pol polyprotein from transposon 412 from Sophophora with 25.32% of identity
• Blastx: Retrovirus-related Pol polyprotein from transposon 297 from Sophophora with 39.87% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019459949.1)
• Pfam: Retrotransposon gag protein (PF03732.16)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;