| Transcript | Ll_transcript_494098 |
|---|---|
| CDS coordinates | 163-576 (+) |
| Peptide sequence | MEANKTTFCHWQSQEGINDLAYWLSTTSTLLFYLQCTLKASNSTRAVSRNRNSPATLFGKMAQGLRSSSIGVGFSSGYSGLVDKPNEQSKVEAKYPAILFKQHLTAYVEKIYGMVRDSIKKEISPFLNLCIQVTIIF* |
| ORF Type | complete |
| Blastp | Myosin-12 from Arabidopsis with 62.3% of identity |
|---|---|
| Blastx | Myosin-12 from Arabidopsis with 54.55% of identity |
| Eggnog | myosin heavy chain(COG5022) |
| Kegg | Link to kegg annotations (AT2G31900) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019425376.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer