Protein coding transcript 127282

• Transcript: Ll_transcript_492385
• CDS coordinates: 2-964 (+)
• Peptide sequence: NLVNQATAKASLIQMLVIVFRRMEADSSTVPIQPIVVAELMEPMEKSDVDKSMQFVQGFITKNMQDNGVLNPVTSSSKNGHDGTFQNAVVQTINPADLLDCTDKDMLDAKHWEISMYKTALEGRKGELVDGEEVVERDDDSQVQIVNNLRRDAFLVFRALCKLSMKTLPKDVSSDLQSLKGKILALELLKILLENAGAVFRTSERFLGAIKQYLCLSLLKNSASTVMIVFQLSCSIFISLVSRFRAGLKAEIGVFFPMIVLRVLENVAQSDFQQKMTVLRFLEKLCVDSQILVDIFINYDCDVNSPNIFERMVNGLLKTAQ
• ORF Type: internal

Annotations of Ll_transcript_492385

• Blastp: Brefeldin A-inhibited guanine nucleotide-exchange protein 3 from Arabidopsis with 80.56% of identity
• Blastx: Brefeldin A-inhibited guanine nucleotide-exchange protein 3 from Arabidopsis with 79.32% of identity
• Eggnog: and Sec7 domain(COG5307)
• Kegg: Link to kegg annotations (AT1G01960)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019432960.1)
• Pfam: Guanine nucleotide exchange factor in Golgi transport N-terminal (PF12783.6)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;