Transcript | Ll_transcript_492418 |
---|---|
CDS coordinates | 1426-1743 (+) |
Peptide sequence | MSCSLGARMGMWSYAQDCSKRRQPPTSFCSFIVAARQRPRYKIANTVDPQLYSKVSDKSSSNGRYIKWIRDPDVSGSKNPPIILRMKARACCSTTSSSASSGSCW* |
ORF Type | complete |
Blastp | Protein MAIN-LIKE 2 from Arabidopsis with 41.01% of identity |
---|---|
Blastx | Protein MAIN-LIKE 2 from Arabidopsis with 41.01% of identity |
Eggnog | Serine threonine-protein phosphatase 7 long form(ENOG410YC97) |
Kegg | Link to kegg annotations (AT2G04865) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019432591.1) |
Pfam | Plant mobile domain (PF10536.8) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer