Protein coding transcript 127400

• Transcript: Ll_transcript_494332
• CDS coordinates: 2-1024 (+)
• Peptide sequence: ICRNSNLYEPLLVEEEPGCLKVTPYRDAGFFSLATLSWLNPLLSIGAKRPLELKDIPLVAPKDRAKASYKVLNSNWEKLKAENPSKQPSLAWAILKSFWKEAAVNAIFAGLNTLVSYVGPYMISYFVDYLSGKETFPNEGYVLAGIFFVAKLVETLTTRQWYLGVDILGMHVRSALTAMVYRKGLRLSSSAKQSHTSGEIVNYMAVDVQRVGDYSWYLHDMWMLPMQIVLALLILYKNVGIASVATLIATIISIVVTIPVARIQEDYQDKLMAAKDERMRKTSECLRNMRILKLQAWEHRYQLQLEEMRGVEYKWLRKALYSQACITFMFWSSPIFVSAVT
• ORF Type: internal

Annotations of Ll_transcript_494332

• Blastp: ABC transporter C family member 5 from Arabidopsis with 81.95% of identity
• Blastx: ABC transporter C family member 5 from Arabidopsis with 81.95% of identity
• Eggnog: (ABC) transporter(COG1132)
• Kegg: Link to kegg annotations (AT1G04120)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019427850.1)
• Pfam: ABC transporter transmembrane region (PF00664.22)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;