Protein coding transcript 127427

• Transcript: Ll_transcript_494613
• CDS coordinates: 2-904 (+)
• Peptide sequence: KHRHIVETGLTLLSHAGLPLTFWEFAFTTAVFLINRLPTATLNNLSPFFLLFGKFPCYTSLRIFGCACFPLLRPYNAHKLAYRSTECTFLGYSSMHKGYKCLSPDGRIYISKDVKFNESAFPFKTSNNTSPSFSNPHINDGILPTPTHTHTFTETLHPSSNPSPTSITSSPSPSSHIPHTPSTPISASSTNNSSTNSNNPHSSPTTTTSPLPSPTTTAPADSDSSLLPLPPTSAPIPSHPMTTRSKAGITKSILPNLASLFLVHTEPSSVKEALLNPTWKSAMQEEYDALLKLGTWTLVPL
• ORF Type: internal

Annotations of Ll_transcript_494613

• Blastp: Retrovirus-related Pol polyprotein from transposon TNT 1-94 from Nicotiana with 27.12% of identity
• Blastx: Retrovirus-related Pol polyprotein from transposon TNT 1-94 from Nicotiana with 36.13% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019435087.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;