Protein coding transcript 127430

• Transcript: Ll_transcript_492525
• CDS coordinates: 3-404 (+)
• Peptide sequence: QGGGRDVTVEVIDRGQSQGFGLTLVETMIFGCDEATSALDSTTEAEILSASKSLANNRTSIFIAHRLTTAMQCDEIIALENGKVTEQGPMRCSYQMEEDMHSFGDIEITHMMQLIQASNLVHKNTRKFLPFLS*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_492525

• Blastp: ABC transporter B family member 25, mitochondrial from Arabidopsis with 85.25% of identity
• Blastx: ABC transporter B family member 25, mitochondrial from Arabidopsis with 85.25% of identity
• Eggnog: iron ion homeostasis(COG5265)
• Kegg: Link to kegg annotations (AT5G58270)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019432494.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;