Protein coding transcript 127432

• Transcript: Ll_transcript_492523
• CDS coordinates: 3-314 (+)
• Peptide sequence: QGGGRDVTVEVIDRGQSQGFGLTLVETMIFGCDEATSALDSTTEAEILSASKSLANNRTSIFIAHRLTTAMQCDEIIALENGKGTEQGPHEVLISNGGRYAQL*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_492523

• Blastp: ABC transporter B family member 25, mitochondrial from Arabidopsis with 78.67% of identity
• Blastx: ABC transporter B family member 25, mitochondrial from Arabidopsis with 73.81% of identity
• Eggnog: iron ion homeostasis(COG5265)
• Kegg: Link to kegg annotations (AT5G58270)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_020238628.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;