Transcript | Ll_transcript_357799 |
---|---|
CDS coordinates | 148-516 (+) |
Peptide sequence | MAYAAVKPTKPGLEEPVEQIHKIRITLSSKNVQNLEKVCTDLVRGAKDKRLRVKGPVRIPTKVLKITTRKTPCGEGTNTWDRFELRVHKRVIDLFSSPEVVKQITSITIEPGVEVEVTIADA* |
ORF Type | complete |
Blastp | 40S ribosomal protein S20-2 from Arabidopsis with 90.98% of identity |
---|---|
Blastx | 40S ribosomal protein S20-2 from Arabidopsis with 90.98% of identity |
Eggnog | tRNA binding(COG0051) |
Kegg | Link to kegg annotations (AT3G47370) |
CantataDB | Link to cantataDB annotations (CNT0001524) |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019454406.1) |
Pfam | Ribosomal protein S10p/S20e (PF00338.21) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer