Protein coding transcript 12747

• Transcript: Ll_transcript_357802
• CDS coordinates: 1-441 (+)
• Peptide sequence: QTLASPSFQQSRDFLLFHCQSQEIMAYAAVKPTKPGLEEPVEQIHKIRITLSSKNVQNLEKVCTDLVRGAKDKRLRVKGPVRIPTKVLKITTRKTPCGEGTNTWDRFELRVHKRVIDLFSSPEVVKQITSITIEPGVEVEVTIADA*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_357802

• Blastp: 40S ribosomal protein S20-2 from Arabidopsis with 90.98% of identity
• Blastx: 40S ribosomal protein S20-2 from Arabidopsis with 90.98% of identity
• Eggnog: tRNA binding(COG0051)
• Kegg: Link to kegg annotations (AT3G47370)
• CantataDB: Link to cantataDB annotations (CNT0001524)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019454406.1)
• Pfam: Ribosomal protein S10p/S20e (PF00338.21)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;