Protein coding transcript 127513

• Transcript: Ll_transcript_493144
• CDS coordinates: 1310-1879 (+)
• Peptide sequence: MVYTGSMQHKNDPLLSVSDSEDPSLHFRWWYIVRLLQWHHTEGLLLPSLVIDWVLSQLQEKDLLEVWQLLLPIIYGFLETVVLSQTYVRTLAGIALRVIRDPAPGGSDLVDNSRRAYTTYALIEMLRYLILAVPDTFVGLDCFPLPSSVVSHTINDGNFALKSIEAAGTIKNSTDDFGHVVSSIHKNAEY
• ORF Type: 3prime_partial

Annotations of Ll_transcript_493144

• Blastp: Mediator of RNA polymerase II transcription subunit 12 from Arabidopsis with 59.89% of identity
• Blastx: Mediator of RNA polymerase II transcription subunit 12 from Arabidopsis with 65.63% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (AT4G00450)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019428546.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;