Protein coding transcript 127514

• Transcript: Ll_transcript_493161
• CDS coordinates: 3-962 (+)
• Peptide sequence: GVFPELRQCGEDFRKKWIEGLSQPHKRLHSLADQVPHGYKKASLLEVLIRNNVPLLRANWFIKVTYLNQVRPGSVGISSGTADKIQLSRSEVWTKDVINYLQTLLDDFLSKNTSHSTLRSTPHARERSAQMVYTGSMQHKNDPLLSVSDSEDPSLHFRWWYIVRLLQWHHTEGLLLPSLVIDWVLSQLQEKDLLEVWQLLLPIIYGFLETVVLSQTYVRTLAGIALRVIRDPSPGGSDLVDNSRRAYTTYALIEMLRYLILAVPDTFVGLDCFPLPSSVVSHTINDGNFALKSIEAAGTIKNSTDDFGHVVSSIHKNAEY
• ORF Type: internal

Annotations of Ll_transcript_493161

• Blastp: Mediator of RNA polymerase II transcription subunit 12 from Arabidopsis with 64.16% of identity
• Blastx: Mediator of RNA polymerase II transcription subunit 12 from Arabidopsis with 64.16% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (AT4G00450)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019428546.1)
• Pfam: Transcription mediator complex subunit Med12 (PF09497.9)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;