Protein coding transcript 127517

• Transcript: Ll_transcript_493168
• CDS coordinates: 726-1295 (+)
• Peptide sequence: MVYTGSMQHKNDPLLSVSDSEDPSLHFRWWYIVRLLQWHHTEGLLLPSLVIDWVLSQLQEKDLLEVWQLLLPIIYGFLETVVLSQTYVRTLAGIALRVIRDPAPGGSDLVDNSRRAYTTYALIEMLRYLILAVPDTFVGLDCFPLPSSVVSHTINDGNFALKSIEAAGTIKNSTDDFGHVVSSIHKNAEY
• ORF Type: 3prime_partial

Annotations of Ll_transcript_493168

• Blastp: Mediator of RNA polymerase II transcription subunit 12 from Arabidopsis with 59.89% of identity
• Blastx: Mediator of RNA polymerase II transcription subunit 12 from Arabidopsis with 66.07% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (AT4G00450)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019428546.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;