| Transcript | Ll_transcript_493158 |
|---|---|
| CDS coordinates | 393-692 (+) |
| Peptide sequence | MQRYHAGSCTSAVNTSAVGGTSPRDSGRSDLSSLPAKEAIRKRLRAINESRAQKRKAGQIYGVPLSGSQLAKPGIFPELRPCGEDFRKKWIEGLSQPHK* |
| ORF Type | complete |
| Blastp | Mediator of RNA polymerase II transcription subunit 12 from Arabidopsis with 76.19% of identity |
|---|---|
| Blastx | Mediator of RNA polymerase II transcription subunit 12 from Arabidopsis with 74.77% of identity |
| Eggnog | - |
| Kegg | Link to kegg annotations (AT4G00450) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019461031.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer