Transcript | Ll_transcript_357390 |
---|---|
CDS coordinates | 229-618 (+) |
Peptide sequence | MFQHIAPVQLIDPFTNTNLRIWLDHPVLYGPQKERNSKLRKDTLFPFECRQAKISYTGKFTADVCFQYGGGAIIRENIDFGQFPIMLQVRSTGTIDQVTRQPIKGRKRGGGIRFGEMEVENHFHFSKSNS |
ORF Type | 3prime_partial |
Blastp | DNA-directed RNA polymerase I subunit 2 from Arabidopsis with 57.14% of identity |
---|---|
Blastx | DNA-directed RNA polymerase I subunit 2 from Arabidopsis with 55.1% of identity |
Eggnog | DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates (By similarity)(COG0085) |
Kegg | Link to kegg annotations (AT1G29940) |
CantataDB | Link to cantataDB annotations (CNT0002751) |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019449317.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer