Protein coding transcript 12758

• Transcript: Ll_transcript_357392
• CDS coordinates: 768-1265 (+)
• Peptide sequence: MVVKFIWGCLPFSCNWCLCLTCILLWLDHPVLYGPQKERNSKLRKDTLFPFECRQAKISYTGKFTADVCFQYGGGAIIRENIDFGQFPIMLQVRSTGTIDQVTRQPIKGRKRGGGIRFGEMEVILYLLMEQHILCMIGCIPVLIITLLMYVPYAEACSTQLLSSH*
• ORF Type: complete

Annotations of Ll_transcript_357392

• Blastp: DNA-directed RNA polymerase I subunit 2 from Arabidopsis with 61.76% of identity
• Blastx: DNA-directed RNA polymerase I subunit 2 from Arabidopsis with 73.83% of identity
• Eggnog: DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates (By similarity)(COG0085)
• Kegg: Link to kegg annotations (AT1G29940)
• CantataDB: Link to cantataDB annotations (CNT0002751)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019449317.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;