Transcript | Ll_transcript_493072 |
---|---|
CDS coordinates | 1130-1717 (+) |
Peptide sequence | MKKGSVGFKPENLDQPDIPSTWRALEALYDSGKARAIGVSNFSSKKLQDLLEIAQVPPAVNQVELHPAWQQPKLRAFCESKGIHLSGYSPLGSPGVLKSDILKNPAISVVAEKLGKSPAQVALRWGLQTGHSVLPKSTSEARIKENFDVFDWSIPEDLIAKISEIKQDRLIKGTGFVHETYGFYKTIEELWDGEQ* |
ORF Type | complete |
Blastp | NADPH-dependent aldo-keto reductase, chloroplastic from Arabidopsis with 75% of identity |
---|---|
Blastx | NADPH-dependent aldo-keto reductase, chloroplastic from Arabidopsis with 74.71% of identity |
Eggnog | reductase(COG0656) |
Kegg | Link to kegg annotations (AT2G37770) |
CantataDB | Link to cantataDB annotations (CNT0001532) |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019430790.1) |
Pfam | Aldo/keto reductase family (PF00248.20) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer