Protein coding transcript 127839

• Transcript: Ll_transcript_494343
• CDS coordinates: 1-828 (+)
• Peptide sequence: WFQFQNFLKSHSKDTDPSKFVPSKKRSGTNGLPEQHVLRIFSVGATNNDNAAYTELYLQEDGVLNLATSNSSFLSLSGLELEEGRWHHLAVIHSKPNSFAGLFQASVAYVYLNGKLMHTGKLGYSPSPVGTPLQVTIGTSVGNARVSDLTWKLRSCYLFEEVLTPGCICFMYILGRGYRGIFQDTDLLQFVPNQACGGGSMAILDSLNADLTLAASGQRLDSSSKQGDLKADGSGIVWDLERLGNLSLQLSGKKLIFAFDGTSTEFVPSSSSFSML
• ORF Type: internal

Annotations of Ll_transcript_494343

• Blastp: Protein SPIRRIG from Arabidopsis with 70.4% of identity
• Blastx: Protein SPIRRIG from Arabidopsis with 71.27% of identity
• Eggnog: beige BEACH domain containing protein(ENOG410XNQC)
• Kegg: Link to kegg annotations (AT1G03060)
• CantataDB: Link to cantataDB annotations (CNT0002534)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019428215.1)
• Pfam: Concanavalin A-like lectin/glucanases superfamily (PF13385.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;