Protein coding transcript 127883

• Transcript: Ll_transcript_493695
• CDS coordinates: 117-512 (+)
• Peptide sequence: MASALVGGAFLSGFINVVFDRLLSPEALNLIKGKKLDQHLVQRLKTALLAAGALVTDAEMKQFCNKDVKDWLDSLKDALYVADDLLDLILTKAATQNKNKAYQSGHLFYFCWEYKACYPWFHKSLLEDSCKK
• ORF Type: 3prime_partial

Annotations of Ll_transcript_493695

• Blastp: Putative disease resistance RPP13-like protein 1 from Arabidopsis with 39.13% of identity
• Blastx: Putative disease resistance RPP13-like protein 1 from Arabidopsis with 36.76% of identity
• Eggnog: leucine Rich Repeat(COG4886)
• Kegg: Link to kegg annotations (AT3G14470)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019454470.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;