Transcript | Ll_transcript_357970 |
---|---|
CDS coordinates | 675-1352 (+) |
Peptide sequence | MPKSDAIHEFKRLFFEKTANPWEAWEQKTIKKQPGRFFPLDIDYGVNKQVSKKKNNDEDSKLPPPLIELMKMLFNVETYRAAMMEFEINMSEMPLGKLSKSNIQRGFEALTDIQNLLKTDNPDPSMLESLLIDASNRFFTMIPSIHPHIIRDEDDFKSKVKMLEALQDIEIASRLVGFDANNDDSIDDNYKKLHCDIAPLPHDSEDYRLIEKFLHNTHAPTHTVC* |
ORF Type | complete |
Blastp | Poly [ADP-ribose] polymerase 1 from Arabidopsis with 79.02% of identity |
---|---|
Blastx | Poly [ADP-ribose] polymerase 1 from Arabidopsis with 79.31% of identity |
Eggnog | Poly (ADP-ribose) polymerase(ENOG410XP18) |
Kegg | Link to kegg annotations (AT2G31320) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019456536.1) |
Pfam | Poly(ADP-ribose) polymerase, regulatory domain (PF02877.13) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer