Protein coding transcript 12813

• Transcript: Ll_transcript_357970
• CDS coordinates: 675-1352 (+)
• Peptide sequence: MPKSDAIHEFKRLFFEKTANPWEAWEQKTIKKQPGRFFPLDIDYGVNKQVSKKKNNDEDSKLPPPLIELMKMLFNVETYRAAMMEFEINMSEMPLGKLSKSNIQRGFEALTDIQNLLKTDNPDPSMLESLLIDASNRFFTMIPSIHPHIIRDEDDFKSKVKMLEALQDIEIASRLVGFDANNDDSIDDNYKKLHCDIAPLPHDSEDYRLIEKFLHNTHAPTHTVC*
• ORF Type: complete

Annotations of Ll_transcript_357970

• Blastp: Poly [ADP-ribose] polymerase 1 from Arabidopsis with 79.02% of identity
• Blastx: Poly [ADP-ribose] polymerase 1 from Arabidopsis with 79.31% of identity
• Eggnog: Poly (ADP-ribose) polymerase(ENOG410XP18)
• Kegg: Link to kegg annotations (AT2G31320)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019456536.1)
• Pfam: Poly(ADP-ribose) polymerase, regulatory domain (PF02877.13)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;