Protein coding transcript 128181

• Transcript: Ll_transcript_275992
• CDS coordinates: 2-1093 (+)
• Peptide sequence: AITTITSSASFSDEVQLNELINFKNSLPNPFLLSNWVPSNTTNLCSFTGITCTPQTRHVSSINLAGITLSTTFAPVSAHLLTLPHLQNITLRSTNLSGFLPTVTNCSNSLVFVDLSHNELNGKTDFSGCINLHYLNISYNNFSSTVPSFGASTSLEYLDISGNRFSGDISGELFGCKNLIYLNASSNKLSGPVPTLPVGGVMKFLYLARNNFWGEIPVRLAQLCSSLVELDLSLNKLSGSIPGDFSSCSSLESLVLSHNGFSGELPVGVLEKMKSLRKLSLSFNGFSGPLPDSLSRMVSLEFLHLGSNKFEGSIPKGFCEDPRNSLKGLYLEDNLLTGFIPPSLGNCSHLAAMDLSLNYLKGTI
• ORF Type: internal

Annotations of Ll_transcript_275992

• Blastp: Brassinosteroid LRR receptor kinase from Lycopersicon with 38.08% of identity
• Blastx: Brassinosteroid LRR receptor kinase from Lycopersicon with 38.08% of identity
• Eggnog: Serine Threonine protein kinase(COG0515)
• Kegg: Link to kegg annotations (101261320)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019462974.1)
• Pfam: Leucine rich repeat N-terminal domain (PF08263.11)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;